PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT2G13960.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family MYB_related
Protein Properties Length: 115aa    MW: 13665 Da    PI: 9.3917
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AT2G13960.2genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding59.57.5e-194086148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g WT+eEde l +av+++ g++Wk+Ia+ ++  Rt  qc +rwqk+l
      AT2G13960.2 40 KGGWTPEEDETLRRAVEKYKGKRWKKIAEFFP-ERTQVQCLHRWQKVL 86
                     688*****************************.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129424.2793590IPR017930Myb domain
Gene3DG3DSA:1.10.10.609.5E-233697IPR009057Homeodomain-like
SuperFamilySSF466892.1E-193798IPR009057Homeodomain-like
SMARTSM007175.8E-163988IPR001005SANT/Myb domain
PfamPF002493.6E-174086IPR001005SANT/Myb domain
CDDcd001677.80E-144386No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006357Biological Processregulation of transcription from RNA polymerase II promoter
GO:0030154Biological Processcell differentiation
GO:0005634Cellular Componentnucleus
GO:0016021Cellular Componentintegral component of membrane
GO:0000981Molecular FunctionRNA polymerase II transcription factor activity, sequence-specific DNA binding
GO:0001135Molecular Functiontranscription factor activity, RNA polymerase II transcription factor recruiting
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000293anatomyguard cell
PO:0025195anatomypollen tube cell
PO:0025281anatomypollen
PO:0001017developmental stageM germinated pollen stage
Sequence ? help Back to Top
Protein Sequence    Length: 115 aa     Download sequence    Send to blast
MKLIDWKDCA LMTYTELILG FCNVLMLICR RTSGPMRRAK GGWTPEEDET LRRAVEKYKG  60
KRWKKIAEFF PERTQVQCLH RWQKVLNPEL VKGPWTQEVL LSFSCSETFF GFHFT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h88_C1e-193998564MYB PROTO-ONCOGENE PROTEIN
1h89_C1e-193998564MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.649261e-146inflorescence
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO425690171e-146
Genevisible265301_s_at1e-110
Expression AtlasAT2G13960-
AtGenExpressAT2G13960-
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT2G13960.2
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT2G13960
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY5195480.0AY519548.1 Arabidopsis thaliana MYB transcription factor (At2g13960) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001077886.14e-82homeodomain-like superfamily protein
SwissprotQ9S7G71e-32MB3R1_ARATH; Myb-related protein 3R-1
TrEMBLQ9ZPU25e-82Q9ZPU2_ARATH; Homeodomain-like superfamily protein
STRINGAT2G13960.12e-58(Arabidopsis thaliana)
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Wu XM,Lim SH,Yang WC
    Characterization, expression and phylogenetic study of R2R3-MYB genes in orchid.
    Plant Mol. Biol., 2003. 51(6): p. 959-72
    [PMID:12777054]
  3. Yanhui C, et al.
    The MYB transcription factor superfamily of Arabidopsis: expression analysis and phylogenetic comparison with the rice MYB family.
    Plant Mol. Biol., 2006. 60(1): p. 107-24
    [PMID:16463103]
  4. Wang Y, et al.
    Transcriptome analyses show changes in gene expression to accompany pollen germination and tube growth in Arabidopsis.
    Plant Physiol., 2008. 148(3): p. 1201-11
    [PMID:18775970]